PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G34420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 797aa    MW: 82339.8 Da    PI: 6.6447
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G34420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.8e-095886251954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  ORUFI03G34420.1 588 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 625
                      564459******************************88 PP

2BELL84.31.4e-274685192172
             BELL  21 krYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  ORUFI03G34420.1 468 SRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 519
                      69***********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.5E-40408517IPR006563POX domain
PfamPF075261.3E-6413459IPR006563POX domain
PfamPF075261.8E-24468516IPR006563POX domain
PROSITE profilePS5007112.6566629IPR001356Homeobox domain
SMARTSM003891.6E-9569633IPR001356Homeobox domain
CDDcd000864.64E-13569630No hitNo description
SuperFamilySSF466892.74E-17571636IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28572635IPR009057Homeodomain-like
PfamPF059204.1E-18586625IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 797 aa     Download sequence    Send to blast
MERRRSRRQQ AFHPVAAEEE EEEGLVVVGR RSTADDGDSG AAGMGIAAPP CQPGQTTTFV  60
ISQPTSSKSS PAAIVVRPPA TASSSSMSHS QGFHQPSSGA VFGFSSDGFD GRPGSGQDHQ  120
QHEQQQQQHV AQQSRRDKLR VQGFDPAAAA AGHGLLPIEG DEHGAEPGAM YDHAEAAAAG  180
ASNMLSEMFN FPSQPPTGPS ATELLASQMN ANYRFGFRQA AGLAGGEGGW FGGGGAAGRT  240
GLVLGGASLG SLGETSSPKQ QASGMAGLAA DPAAAMHLFL MNPQQQQSRS STSPPPSDAQ  300
SAIHQHHEAF QAFGGAGAAA FGGGAAAGVV EGQGLSLSLS PSLQQLEMAK QAEELRVRDG  360
VLYFNRQQQQ QQAAAAAASV QQQLPMALHG QVGVLGQQLH GGGYGGPAGV AGVLRNSKYT  420
RAAQELLEEF CSVGRGQIKG GGGGGSAPNN PNSSKAAASS SGAAQSPSRY NHYCDQMQMV  480
VNFFDSVMGF GAATPYTALA QKAMSRHFRC LKDAIAAQLR GTCEALGEKD AGTGSGLTKG  540
ETPRLRAIDQ SLRQQRAFHH MGIMEQEAWR PQRGLPERSV NILRSWLFEH FLHPYPSDAD  600
KHLLARQTGL SRNQVSNWFI NARVRLWKPM IEEMYQQECK ELEGSSGAGD DPSGADDTHS  660
PTTTAAAHHQ HRHGQLMVEH GGASSGGGAA MSSHKHEPGV VAGPSSSSAA AVADAAFVGI  720
DPVELLGGDG AAADDLYGRF DPAGAVRVRY GPAGAAAGAA AAAAGDVSLT LGLQHAGAGN  780
AGPDGSGRFS LRDYSGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A8e-18575633159Homeobox protein Meis2
5bng_B8e-18575633159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1035500.0AC103550.13 Oryza sativa chromosome 3 BAC OSJNBa0079G12 genomic sequence, complete sequence.
GenBankAK2874760.0AK287476.1 Oryza sativa Japonica Group cDNA, clone: J043023B19, full insert sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631398.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLA0A0E0P0V70.0A0A0E0P0V7_ORYRU; Uncharacterized protein
STRINGLOC_Os03g52239.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-100BEL1-like homeodomain 2